SCOPe 2.07: Domain d3huta1: 3hut A:40-384

Lineage for d3huta1 (3hut A:40-384)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (71 species)
   not a true protein

7. Species Rhodospirillum rubrum [TaxId:269796] [255869] (1 PDB entry)

8. Domain d3huta1: 3hut A:40-384 [246576]
   Other proteins in same PDB: d3huta2
   automated match to d4gnra_

Details for d3huta1

PDB Entry: 3hut, 1.93 Å

PDB Description: Crystal structure of a putative branched-chain amino acid ABC transporter from Rhodospirillum rubrum

PDB Compounds: (A:) putative Branched-chain amino acid ABC transporter

SCOPe Domain Sequences for d3huta1:

Sequence; same for both SEQRES and ATOM records:

>d3huta1 c.93.1.0 (A:40-384) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
alllgyelpltganaaygrvfqeaarlqldrfnaaggvggrpvdilyadsrddadqarti
arafvddprvvgvlgdfsstvsmaagsiygkegmpqlsptaahpdyikispwqfraittp
afegpnnaawmigdgftsvavigvttdwglssaqafrkafelrggavvvneevppgnrrf
ddvideiedeapqaiylamayedaapflralrargsalpvygssalyspkfidlggpave
gvrlatafvlgasdpvvvefvsayetlygaiptlfaahgydavgimlaavgragpevtre
slrdalaatdryagvtgitrfdpetrettkiltrlvvregdfrvi

Timeline for d3huta1:

• d3huta1 first appeared in SCOPe 2.04, called d3huta_
  
• d3huta1 appears in SCOPe 2.06