![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
![]() | Protein automated matches [190646] (77 species) not a true protein |
![]() | Species Rhodospirillum rubrum [TaxId:269796] [255869] (1 PDB entry) |
![]() | Domain d3huta1: 3hut A:40-384 [246576] Other proteins in same PDB: d3huta2 automated match to d4gnra_ |
PDB Entry: 3hut (more details), 1.93 Å
SCOPe Domain Sequences for d3huta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3huta1 c.93.1.0 (A:40-384) automated matches {Rhodospirillum rubrum [TaxId: 269796]} alllgyelpltganaaygrvfqeaarlqldrfnaaggvggrpvdilyadsrddadqarti arafvddprvvgvlgdfsstvsmaagsiygkegmpqlsptaahpdyikispwqfraittp afegpnnaawmigdgftsvavigvttdwglssaqafrkafelrggavvvneevppgnrrf ddvideiedeapqaiylamayedaapflralrargsalpvygssalyspkfidlggpave gvrlatafvlgasdpvvvefvsayetlygaiptlfaahgydavgimlaavgragpevtre slrdalaatdryagvtgitrfdpetrettkiltrlvvregdfrvi
Timeline for d3huta1: