Lineage for d3huta1 (3hut A:40-384)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913541Species Rhodospirillum rubrum [TaxId:269796] [255869] (1 PDB entry)
  8. 2913542Domain d3huta1: 3hut A:40-384 [246576]
    Other proteins in same PDB: d3huta2
    automated match to d4gnra_

Details for d3huta1

PDB Entry: 3hut (more details), 1.93 Å

PDB Description: crystal structure of a putative branched-chain amino acid abc transporter from rhodospirillum rubrum
PDB Compounds: (A:) putative Branched-chain amino acid ABC transporter

SCOPe Domain Sequences for d3huta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3huta1 c.93.1.0 (A:40-384) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
alllgyelpltganaaygrvfqeaarlqldrfnaaggvggrpvdilyadsrddadqarti
arafvddprvvgvlgdfsstvsmaagsiygkegmpqlsptaahpdyikispwqfraittp
afegpnnaawmigdgftsvavigvttdwglssaqafrkafelrggavvvneevppgnrrf
ddvideiedeapqaiylamayedaapflralrargsalpvygssalyspkfidlggpave
gvrlatafvlgasdpvvvefvsayetlygaiptlfaahgydavgimlaavgragpevtre
slrdalaatdryagvtgitrfdpetrettkiltrlvvregdfrvi

SCOPe Domain Coordinates for d3huta1:

Click to download the PDB-style file with coordinates for d3huta1.
(The format of our PDB-style files is described here.)

Timeline for d3huta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3huta2