![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily) sandwich; 6 strands in 2 sheets |
![]() | Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) ![]() |
![]() | Family b.105.1.2: Pencillin binding protein 4 (PbpD), C-terminal domain [110098] (1 protein) rudiment form of the PBP-5-like domain automatically mapped to Pfam PF09211 |
![]() | Protein Pencillin binding protein 4 (PbpD), C-terminal domain [110099] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [110100] (3 PDB entries) Uniprot Q53613 21-383 |
![]() | Domain d3hunb2: 3hun B:316-383 [246575] Other proteins in same PDB: d3huna1, d3hunb1 automated match to d3humb2 complexed with zz7 |
PDB Entry: 3hun (more details), 2 Å
SCOPe Domain Sequences for d3hunb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hunb2 b.105.1.2 (B:316-383) Pencillin binding protein 4 (PbpD), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg pptvevhq
Timeline for d3hunb2: