SCOPe 2.08: Domain d3huna1: 3hun A:25-315

Lineage for d3huna1 (3hun A:25-315)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Pencillin binding protein 4 (PbpD), N-terminal domain [111287] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [111288] (3 PDB entries)
   Uniprot Q53613 21-383

8. Domain d3huna1: 3hun A:25-315 [246572]
   Other proteins in same PDB: d3huna2, d3hunb2
   automated match to d3humb1
   complexed with zz7

Details for d3huna1

PDB Entry: 3hun, 2 Å

PDB Description: crystal structure of penicillin binding protein 4 from staphylococcus aureus col in complex with ampicillin

PDB Compounds: (A:) Penicillin-binding protein 4

SCOPe Domain Sequences for d3huna1:

Sequence; same for both SEQRES and ATOM records:

>d3huna1 e.3.1.1 (A:25-315) Pencillin binding protein 4 (PbpD), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrsfaptkykdqertvtt
ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy

Timeline for d3huna1:

• d3huna1 first appeared in SCOPe 2.04
  
• d3huna1 appears in SCOPe 2.07