SCOPe 2.08: Domain d3hu3b2: 3hu3 B:107-200

Lineage for d3hu3b2 (3hu3 B:107-200)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families)

5. Family d.31.1.0: automated matches [254296] (1 protein)
   not a true family

6. Protein automated matches [254681] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255866] (6 PDB entries)

8. Domain d3hu3b2: 3hu3 B:107-200 [246570]
   Other proteins in same PDB: d3hu3a1, d3hu3a3, d3hu3b1, d3hu3b3
   automated match to d1e32a3
   complexed with ags, mg; mutant

Details for d3hu3b2

PDB Entry: 3hu3, 2.2 Å

PDB Description: Structure of p97 N-D1 R155H mutant in complex with ATPgS

PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3hu3b2:

Sequence; same for both SEQRES and ATOM records:

>d3hu3b2 d.31.1.0 (B:107-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvhggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

Timeline for d3hu3b2:

• d3hu3b2 first appeared in SCOPe 2.04
  
• d3hu3b2 appears in SCOPe 2.07