Lineage for d3hu3b1 (3hu3 B:17-106)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798408Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1798462Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1798647Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 1798648Protein automated matches [191195] (6 species)
    not a true protein
  7. 1798667Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries)
  8. 1798669Domain d3hu3b1: 3hu3 B:17-106 [246569]
    Other proteins in same PDB: d3hu3a2, d3hu3a3, d3hu3b2, d3hu3b3
    automated match to d1e32a1
    complexed with ags, mg; mutant

Details for d3hu3b1

PDB Entry: 3hu3 (more details), 2.2 Å

PDB Description: Structure of p97 N-D1 R155H mutant in complex with ATPgS
PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3hu3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hu3b1 b.52.2.0 (B:17-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt
csdekirmnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d3hu3b1:

Click to download the PDB-style file with coordinates for d3hu3b1.
(The format of our PDB-style files is described here.)

Timeline for d3hu3b1: