| Class b: All beta proteins [48724] (176 folds) |
| Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
| Family b.52.2.0: automated matches [191648] (1 protein) not a true family |
| Protein automated matches [191195] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries) |
| Domain d3hu3a1: 3hu3 A:17-106 [246566] Other proteins in same PDB: d3hu3a2, d3hu3a3, d3hu3b2, d3hu3b3 automated match to d1e32a1 complexed with ags, mg; mutant |
PDB Entry: 3hu3 (more details), 2.2 Å
SCOPe Domain Sequences for d3hu3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hu3a1 b.52.2.0 (A:17-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt
csdekirmnrvvrnnlrvrlgdvisiqpcp
Timeline for d3hu3a1: