Lineage for d3hu2f3 (3hu2 F:201-463)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479418Protein automated matches [190766] (7 species)
    not a true protein
  7. 2479475Species Human (Homo sapiens) [TaxId:9606] [255867] (6 PDB entries)
  8. 2479491Domain d3hu2f3: 3hu2 F:201-463 [246565]
    Other proteins in same PDB: d3hu2a1, d3hu2a2, d3hu2b1, d3hu2b2, d3hu2c1, d3hu2c2, d3hu2d1, d3hu2d2, d3hu2e1, d3hu2e2, d3hu2f1, d3hu2f2
    automated match to d1e32a2
    complexed with ags, mg; mutant

Details for d3hu2f3

PDB Entry: 3hu2 (more details), 2.85 Å

PDB Description: structure of p97 n-d1 r86a mutant in complex with atpgs
PDB Compounds: (F:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3hu2f3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hu2f3 c.37.1.20 (F:201-463) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsqsnpsa

SCOPe Domain Coordinates for d3hu2f3:

Click to download the PDB-style file with coordinates for d3hu2f3.
(The format of our PDB-style files is described here.)

Timeline for d3hu2f3: