Lineage for d3hu2f1 (3hu2 F:12-106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550393Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1550447Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1550627Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 1550628Protein automated matches [191195] (6 species)
    not a true protein
  7. 1550647Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries)
  8. 1550663Domain d3hu2f1: 3hu2 F:12-106 [246563]
    Other proteins in same PDB: d3hu2a2, d3hu2a3, d3hu2b2, d3hu2b3, d3hu2c2, d3hu2c3, d3hu2d2, d3hu2d3, d3hu2e2, d3hu2e3, d3hu2f2, d3hu2f3
    automated match to d1e32a1
    complexed with ags, mg; mutant

Details for d3hu2f1

PDB Entry: 3hu2 (more details), 2.85 Å

PDB Description: structure of p97 n-d1 r86a mutant in complex with atpgs
PDB Compounds: (F:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3hu2f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hu2f1 b.52.2.0 (F:12-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavciv
lsddtcsdekirmnavvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d3hu2f1:

Click to download the PDB-style file with coordinates for d3hu2f1.
(The format of our PDB-style files is described here.)

Timeline for d3hu2f1: