Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein automated matches [190766] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255867] (6 PDB entries) |
Domain d3hu2e3: 3hu2 E:201-463 [246562] Other proteins in same PDB: d3hu2a1, d3hu2a2, d3hu2b1, d3hu2b2, d3hu2c1, d3hu2c2, d3hu2d1, d3hu2d2, d3hu2e1, d3hu2e2, d3hu2f1, d3hu2f2 automated match to d1e32a2 complexed with ags, mg; mutant |
PDB Entry: 3hu2 (more details), 2.85 Å
SCOPe Domain Sequences for d3hu2e3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hu2e3 c.37.1.20 (E:201-463) automated matches {Human (Homo sapiens) [TaxId: 9606]} vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae vmnslavtmddfrwalsqsnpsa
Timeline for d3hu2e3: