Lineage for d3hu2d1 (3hu2 D:12-106)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798408Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1798462Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1798647Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 1798648Protein automated matches [191195] (6 species)
    not a true protein
  7. 1798667Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries)
  8. 1798681Domain d3hu2d1: 3hu2 D:12-106 [246557]
    Other proteins in same PDB: d3hu2a2, d3hu2a3, d3hu2b2, d3hu2b3, d3hu2c2, d3hu2c3, d3hu2d2, d3hu2d3, d3hu2e2, d3hu2e3, d3hu2f2, d3hu2f3
    automated match to d1e32a1
    complexed with ags, mg; mutant

Details for d3hu2d1

PDB Entry: 3hu2 (more details), 2.85 Å

PDB Description: structure of p97 n-d1 r86a mutant in complex with atpgs
PDB Compounds: (D:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3hu2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hu2d1 b.52.2.0 (D:12-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavciv
lsddtcsdekirmnavvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d3hu2d1:

Click to download the PDB-style file with coordinates for d3hu2d1.
(The format of our PDB-style files is described here.)

Timeline for d3hu2d1: