Class b: All beta proteins [48724] (176 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.0: automated matches [191648] (1 protein) not a true family |
Protein automated matches [191195] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries) |
Domain d3hu2d1: 3hu2 D:12-106 [246557] Other proteins in same PDB: d3hu2a2, d3hu2a3, d3hu2b2, d3hu2b3, d3hu2c2, d3hu2c3, d3hu2d2, d3hu2d3, d3hu2e2, d3hu2e3, d3hu2f2, d3hu2f3 automated match to d1e32a1 complexed with ags, mg; mutant |
PDB Entry: 3hu2 (more details), 2.85 Å
SCOPe Domain Sequences for d3hu2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hu2d1 b.52.2.0 (D:12-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} lstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavciv lsddtcsdekirmnavvrnnlrvrlgdvisiqpcp
Timeline for d3hu2d1: