Lineage for d3hu2b2 (3hu2 B:107-200)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1645081Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1645082Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 1645121Family d.31.1.0: automated matches [254296] (1 protein)
    not a true family
  6. 1645122Protein automated matches [254681] (1 species)
    not a true protein
  7. 1645123Species Human (Homo sapiens) [TaxId:9606] [255866] (6 PDB entries)
  8. 1645135Domain d3hu2b2: 3hu2 B:107-200 [246552]
    Other proteins in same PDB: d3hu2a1, d3hu2a3, d3hu2b1, d3hu2b3, d3hu2c1, d3hu2c3, d3hu2d1, d3hu2d3, d3hu2e1, d3hu2e3, d3hu2f1, d3hu2f3
    automated match to d1e32a3
    complexed with ags, mg; mutant

Details for d3hu2b2

PDB Entry: 3hu2 (more details), 2.85 Å

PDB Description: structure of p97 n-d1 r86a mutant in complex with atpgs
PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3hu2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hu2b2 d.31.1.0 (B:107-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

SCOPe Domain Coordinates for d3hu2b2:

Click to download the PDB-style file with coordinates for d3hu2b2.
(The format of our PDB-style files is described here.)

Timeline for d3hu2b2: