Lineage for d3hu2a2 (3hu2 A:107-200)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900730Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1900731Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 1900772Family d.31.1.0: automated matches [254296] (1 protein)
    not a true family
  6. 1900773Protein automated matches [254681] (1 species)
    not a true protein
  7. 1900774Species Human (Homo sapiens) [TaxId:9606] [255866] (6 PDB entries)
  8. 1900785Domain d3hu2a2: 3hu2 A:107-200 [246549]
    Other proteins in same PDB: d3hu2a1, d3hu2a3, d3hu2b1, d3hu2b3, d3hu2c1, d3hu2c3, d3hu2d1, d3hu2d3, d3hu2e1, d3hu2e3, d3hu2f1, d3hu2f3
    automated match to d1e32a3
    complexed with ags, mg; mutant

Details for d3hu2a2

PDB Entry: 3hu2 (more details), 2.85 Å

PDB Description: structure of p97 n-d1 r86a mutant in complex with atpgs
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3hu2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hu2a2 d.31.1.0 (A:107-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

SCOPe Domain Coordinates for d3hu2a2:

Click to download the PDB-style file with coordinates for d3hu2a2.
(The format of our PDB-style files is described here.)

Timeline for d3hu2a2: