| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) ![]() |
| Family d.31.1.0: automated matches [254296] (1 protein) not a true family |
| Protein automated matches [254681] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255866] (6 PDB entries) |
| Domain d3hu1f2: 3hu1 F:107-200 [246546] Other proteins in same PDB: d3hu1a1, d3hu1a3, d3hu1b1, d3hu1b3, d3hu1c1, d3hu1c3, d3hu1d1, d3hu1d3, d3hu1e1, d3hu1e3, d3hu1f1, d3hu1f3 automated match to d1e32a3 complexed with ags, mg; mutant |
PDB Entry: 3hu1 (more details), 2.81 Å
SCOPe Domain Sequences for d3hu1f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hu1f2 d.31.1.0 (F:107-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeeslne
Timeline for d3hu1f2: