Lineage for d3hu1e3 (3hu1 E:201-462)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2871357Protein automated matches [190766] (8 species)
    not a true protein
  7. 2871412Species Human (Homo sapiens) [TaxId:9606] [255867] (6 PDB entries)
  8. 2871421Domain d3hu1e3: 3hu1 E:201-462 [246544]
    Other proteins in same PDB: d3hu1a1, d3hu1a2, d3hu1b1, d3hu1b2, d3hu1c1, d3hu1c2, d3hu1d1, d3hu1d2, d3hu1e1, d3hu1e2, d3hu1f1, d3hu1f2
    automated match to d1e32a2
    complexed with ags, mg; mutant

Details for d3hu1e3

PDB Entry: 3hu1 (more details), 2.81 Å

PDB Description: Structure of p97 N-D1 R95G mutant in complex with ATPgS
PDB Compounds: (E:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3hu1e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hu1e3 c.37.1.20 (E:201-462) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsqsnps

SCOPe Domain Coordinates for d3hu1e3:

Click to download the PDB-style file with coordinates for d3hu1e3.
(The format of our PDB-style files is described here.)

Timeline for d3hu1e3: