Lineage for d3hu1a2 (3hu1 A:107-200)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186568Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186569Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2186627Family d.31.1.0: automated matches [254296] (1 protein)
    not a true family
  6. 2186628Protein automated matches [254681] (2 species)
    not a true protein
  7. 2186634Species Human (Homo sapiens) [TaxId:9606] [255866] (6 PDB entries)
  8. 2186639Domain d3hu1a2: 3hu1 A:107-200 [246531]
    Other proteins in same PDB: d3hu1a1, d3hu1a3, d3hu1b1, d3hu1b3, d3hu1c1, d3hu1c3, d3hu1d1, d3hu1d3, d3hu1e1, d3hu1e3, d3hu1f1, d3hu1f3
    automated match to d1e32a3
    complexed with ags, mg; mutant

Details for d3hu1a2

PDB Entry: 3hu1 (more details), 2.81 Å

PDB Description: Structure of p97 N-D1 R95G mutant in complex with ATPgS
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3hu1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hu1a2 d.31.1.0 (A:107-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

SCOPe Domain Coordinates for d3hu1a2:

Click to download the PDB-style file with coordinates for d3hu1a2.
(The format of our PDB-style files is described here.)

Timeline for d3hu1a2: