Lineage for d3hu1a1 (3hu1 A:12-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412093Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2412166Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2412374Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 2412375Protein automated matches [191195] (10 species)
    not a true protein
  7. 2412404Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries)
  8. 2412409Domain d3hu1a1: 3hu1 A:12-106 [246530]
    Other proteins in same PDB: d3hu1a2, d3hu1a3, d3hu1b2, d3hu1b3, d3hu1c2, d3hu1c3, d3hu1d2, d3hu1d3, d3hu1e2, d3hu1e3, d3hu1f2, d3hu1f3
    automated match to d1e32a1
    complexed with ags, mg; mutant

Details for d3hu1a1

PDB Entry: 3hu1 (more details), 2.81 Å

PDB Description: Structure of p97 N-D1 R95G mutant in complex with ATPgS
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3hu1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hu1a1 b.52.2.0 (A:12-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavciv
lsddtcsdekirmnrvvrnnlrvglgdvisiqpcp

SCOPe Domain Coordinates for d3hu1a1:

Click to download the PDB-style file with coordinates for d3hu1a1.
(The format of our PDB-style files is described here.)

Timeline for d3hu1a1: