Lineage for d1lepe_ (1lep E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2055849Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2055850Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2055851Family b.35.1.1: GroES [50130] (2 proteins)
    automatically mapped to Pfam PF00166
  6. 2055852Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 2055903Species Mycobacterium leprae [TaxId:1769] [50133] (1 PDB entry)
  8. 2055908Domain d1lepe_: 1lep E: [24653]
    CA-atoms only

Details for d1lepe_

PDB Entry: 1lep (more details), 3.5 Å

PDB Description: three-dimensional structure of the immunodominant heat-shock protein chaperonin-10 of mycobacterium leprae
PDB Compounds: (E:) chaperonin-10

SCOPe Domain Sequences for d1lepe_:

Sequence, based on SEQRES records: (download)

>d1lepe_ b.35.1.1 (E:) Chaperonin-10 (GroES) {Mycobacterium leprae [TaxId: 1769]}
akvkikpledkilvqageaetmtpsglvipenakekpqegtvvavgpgrwdedgakripv
dvsegdiviyskyggteikyngeeylilsardvlavvsk

Sequence, based on observed residues (ATOM records): (download)

>d1lepe_ b.35.1.1 (E:) Chaperonin-10 (GroES) {Mycobacterium leprae [TaxId: 1769]}
akvkikpledkilvqaekpqegtvvavgpgrwdedgakripvdvsegdiviyskyggtei
kyngeeylilsardvlavvsk

SCOPe Domain Coordinates for d1lepe_:

Click to download the PDB-style file with coordinates for d1lepe_.
(The format of our PDB-style files is described here.)

Timeline for d1lepe_: