Lineage for d3hqya_ (3hqy A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2350180Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2350181Protein automated matches [190983] (10 species)
    not a true protein
  7. 2350537Species Norway rat (Rattus norvegicus) [TaxId:10116] [255521] (12 PDB entries)
  8. 2350542Domain d3hqya_: 3hqy A: [246525]
    automated match to d4lm1a_
    complexed with mg, pf6, so4, zn

Details for d3hqya_

PDB Entry: 3hqy (more details), 2 Å

PDB Description: discovery of novel inhibitors of pde10a
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d3hqya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hqya_ a.211.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nlparicrdielfhfdigpfenmwpgifvymihrscgtscfeleklcrfimsvkknyrrv
pyhnwkhavtvahcmyailqnnnglftdlerkglliaclchdldhrgfsnsylqkfdhpl
aalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnr
kqleemyqtgslnlhnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegde
mkklgiqpipmmdrdkrdevpqgqlgfynavaipcyttltqilpptepllkacrdnlnqw
ekvir

SCOPe Domain Coordinates for d3hqya_:

Click to download the PDB-style file with coordinates for d3hqya_.
(The format of our PDB-style files is described here.)

Timeline for d3hqya_: