Lineage for d1lepd_ (1lep D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1122089Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1122090Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1122091Family b.35.1.1: GroES [50130] (2 proteins)
  6. 1122092Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 1122143Species Mycobacterium leprae [TaxId:1769] [50133] (1 PDB entry)
  8. 1122147Domain d1lepd_: 1lep D: [24652]
    CA-atoms only

Details for d1lepd_

PDB Entry: 1lep (more details), 3.5 Å

PDB Description: three-dimensional structure of the immunodominant heat-shock protein chaperonin-10 of mycobacterium leprae
PDB Compounds: (D:) chaperonin-10

SCOPe Domain Sequences for d1lepd_:

Sequence, based on SEQRES records: (download)

>d1lepd_ b.35.1.1 (D:) Chaperonin-10 (GroES) {Mycobacterium leprae [TaxId: 1769]}
akvkikpledkilvqageaetmtpsglvipenakekpqegtvvavgpgrwdedgakripv
dvsegdiviyskyggteikyngeeylilsardvlavvsk

Sequence, based on observed residues (ATOM records): (download)

>d1lepd_ b.35.1.1 (D:) Chaperonin-10 (GroES) {Mycobacterium leprae [TaxId: 1769]}
akvkikpledkilvqaekpqegtvvavgpgrwdedgakripvdvsegdiviyskyggtei
kyngeeylilsardvlavvsk

SCOPe Domain Coordinates for d1lepd_:

Click to download the PDB-style file with coordinates for d1lepd_.
(The format of our PDB-style files is described here.)

Timeline for d1lepd_: