Lineage for d3hmxl2 (3hmx L:107-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751853Domain d3hmxl2: 3hmx L:107-214 [246518]
    Other proteins in same PDB: d3hmxb_, d3hmxh_, d3hmxl1
    automated match to d1dn0a2

Details for d3hmxl2

PDB Entry: 3hmx (more details), 3 Å

PDB Description: crystal structure of ustekinumab fab/il-12 complex
PDB Compounds: (L:) ustekinumab fab light chain

SCOPe Domain Sequences for d3hmxl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hmxl2 b.1.1.2 (L:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d3hmxl2:

Click to download the PDB-style file with coordinates for d3hmxl2.
(The format of our PDB-style files is described here.)

Timeline for d3hmxl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hmxl1