SCOPe 2.06: Domain d3hmxb_: 3hmx B:

Lineage for d3hmxb_ (3hmx B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein automated matches [190263] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187052] (12 PDB entries)

8. Domain d3hmxb_: 3hmx B: [246516]
   Other proteins in same PDB: d3hmxl1, d3hmxl2
   automated match to d1f45b_

Details for d3hmxb_

PDB Entry: 3hmx, 3 Å

PDB Description: crystal structure of ustekinumab fab/il-12 complex

PDB Compounds: (B:) Interleukin-12 subunit alpha

SCOPe Domain Sequences for d3hmxb_:

Sequence, based on SEQRES records:

>d3hmxb_ a.26.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfpclhhsqnllravsnmlqkarqtlefypctseeidheditkdktstveaclpleltkn
esclnsretsfitngsclasrktsfmmalclssiyedlkmyqvefktmnakllmdpkrqi
fldqnmlavidelmqalnfnsetvpqkssleepdfyktkiklcillhafriravtidrvm
sylnas

Sequence, based on observed residues (ATOM records):

>d3hmxb_ a.26.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfpclhhsqnllravsnmlqkarqtlefypctsdheditkdktstveaclpleltknesc
etsfitngsclasrktsfmmalclssiyedlkmyqvefktmnakllmdpkrqifldqnml
avidelmqalnfnsetvpsleepdfyktkiklcillhafriravtidrvmsylnas

Timeline for d3hmxb_:

• d3hmxb_ first appeared in SCOPe 2.04
  
• d3hmxb_ appears in SCOPe 2.05
  
• d3hmxb_ appears in SCOPe 2.07
  
• d3hmxb_ appears in the current release, SCOPe 2.08