Lineage for d3hmxb_ (3hmx B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705449Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 2705528Protein automated matches [190263] (1 species)
    not a true protein
  7. 2705529Species Human (Homo sapiens) [TaxId:9606] [187052] (14 PDB entries)
  8. 2705545Domain d3hmxb_: 3hmx B: [246516]
    Other proteins in same PDB: d3hmxh_, d3hmxl1, d3hmxl2
    automated match to d1f45b_

Details for d3hmxb_

PDB Entry: 3hmx (more details), 3 Å

PDB Description: crystal structure of ustekinumab fab/il-12 complex
PDB Compounds: (B:) Interleukin-12 subunit alpha

SCOPe Domain Sequences for d3hmxb_:

Sequence, based on SEQRES records: (download)

>d3hmxb_ a.26.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfpclhhsqnllravsnmlqkarqtlefypctseeidheditkdktstveaclpleltkn
esclnsretsfitngsclasrktsfmmalclssiyedlkmyqvefktmnakllmdpkrqi
fldqnmlavidelmqalnfnsetvpqkssleepdfyktkiklcillhafriravtidrvm
sylnas

Sequence, based on observed residues (ATOM records): (download)

>d3hmxb_ a.26.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfpclhhsqnllravsnmlqkarqtlefypctsdheditkdktstveaclpleltknesc
etsfitngsclasrktsfmmalclssiyedlkmyqvefktmnakllmdpkrqifldqnml
avidelmqalnfnsetvpsleepdfyktkiklcillhafriravtidrvmsylnas

SCOPe Domain Coordinates for d3hmxb_:

Click to download the PDB-style file with coordinates for d3hmxb_.
(The format of our PDB-style files is described here.)

Timeline for d3hmxb_: