SCOPe 2.04: Domain d3hmha_: 3hmh A:

Lineage for d3hmha_ (3hmh A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (182 PDB entries)

8. Domain d3hmha_: 3hmh A: [246510]
   automated match to d3daia_

Details for d3hmha_

PDB Entry: 3hmh, 2.05 Å

PDB Description: Crystal structure of the second bromodomain of human TBP-associated factor RNA polymerase 1-like (TAF1L)

PDB Compounds: (A:) Transcription initiation factor TFIID 210 kDa subunit

SCOPe Domain Sequences for d3hmha_:

Sequence; same for both SEQRES and ATOM records:

>d3hmha_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtenlyfqsmqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykmivnpvdleti
rkniskhkyqsresflddvnlilansvkyngpesqytktaqeivnicyqtiteydehltq
lekdictakeaaleeaele

Timeline for d3hmha_:

• d3hmha_ is new in SCOPe 2.04-stable
  
• d3hmha_ appears in SCOPe 2.05
  
• d3hmha_ appears in the current release, SCOPe 2.08, called d3hmha1