SCOPe 2.08: Domain d3hmha1: 3hmh A:1523-1651

Lineage for d3hmha1 (3hmh A:1523-1651)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d3hmha1: 3hmh A:1523-1651 [246510]
   Other proteins in same PDB: d3hmha2
   automated match to d3daia_

Details for d3hmha1

PDB Entry: 3hmh, 2.05 Å

PDB Description: Crystal structure of the second bromodomain of human TBP-associated factor RNA polymerase 1-like (TAF1L)

PDB Compounds: (A:) Transcription initiation factor TFIID 210 kDa subunit

SCOPe Domain Sequences for d3hmha1:

Sequence; same for both SEQRES and ATOM records:

>d3hmha1 a.29.2.0 (A:1523-1651) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykmivnpvdletirkniskhkyq
sresflddvnlilansvkyngpesqytktaqeivnicyqtiteydehltqlekdictake
aaleeaele

Timeline for d3hmha1:

• d3hmha1 first appeared in SCOPe 2.04, called d3hmha_
  
• d3hmha1 appears in SCOPe 2.07