Lineage for d3hlva_ (3hlv A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009644Domain d3hlva_: 3hlv A: [246504]
    automated match to d3q95b_
    protein/DNA complex; complexed with j2z

Details for d3hlva_

PDB Entry: 3hlv (more details), 3 Å

PDB Description: Crystal structure of human Estrogen Receptor Alpha Ligand-Binding Domain in complex with a Glucocorticoid Receptor Interacting Protein 1 Nr Box II Peptide and 16-alpha-hydroxy-estrone ((8S,9R,13S,14R,16R)-3,16-dihydroxy-13-methyl-7,8,9,11,12,14,15, 16-octahydro-6H-cyclopenta[a]phenanthren-17-one
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d3hlva_:

Sequence, based on SEQRES records: (download)

>d3hlva_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllem
ldahr

Sequence, based on observed residues (ATOM records): (download)

>d3hlva_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nslalsltadqmvsalldaeppilyseydpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytfltlksleekdhihrvldkitdtlih
lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahr

SCOPe Domain Coordinates for d3hlva_:

Click to download the PDB-style file with coordinates for d3hlva_.
(The format of our PDB-style files is described here.)

Timeline for d3hlva_: