SCOPe 2.05: Domain d3hj5a_: 3hj5 A:

Lineage for d3hj5a_ (3hj5 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188783] (8 PDB entries)

8. Domain d3hj5a_: 3hj5 A: [246498]
   automated match to d1fo7a_

Details for d3hj5a_

PDB Entry: 3hj5, 3.1 Å

PDB Description: human prion protein variant v129 domain swapped dimer

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d3hj5a_:

Sequence; same for both SEQRES and ATOM records:

>d3hj5a_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvttttkgenftetdvkmmervveqmcitqyeresqay

Timeline for d3hj5a_:

• d3hj5a_ first appeared in SCOPe 2.04
  
• d3hj5a_ appears in SCOPe 2.06
  
• d3hj5a_ appears in the current release, SCOPe 2.08