Lineage for d3hf1b_ (3hf1 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990319Protein automated matches [190435] (11 species)
    not a true protein
  7. 1990388Species Human (Homo sapiens) [TaxId:9606] [193902] (7 PDB entries)
  8. 1990399Domain d3hf1b_: 3hf1 B: [246493]
    automated match to d1smsa_
    complexed with fe, so4

Details for d3hf1b_

PDB Entry: 3hf1 (more details), 2.6 Å

PDB Description: Crystal structure of human p53R2
PDB Compounds: (B:) ribonucleoside-diphosphate reductase subunit m2 b

SCOPe Domain Sequences for d3hf1b_:

Sequence, based on SEQRES records: (download)

>d3hf1b_ a.25.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
neepllrkssrrfvifpiqypdiwkmykqaqasfwtaeevdlskdlphwnklkadekyfi
shilaffaasdgivnenlverfsqevqvpearcfygfqilienvhsemysllidtyirdp
kkreflfnaietmpyvkkkadwalrwiadrkstfgervvafaavegvffsgsfaaifwlk
krglmpgltfsnelisrdeglhcdfaclmfqylvnkpseervreiivdavkieqefltea
lpvgligmncilmkqyiefvadrllvelgfskvfqaenpfdfmenisl

Sequence, based on observed residues (ATOM records): (download)

>d3hf1b_ a.25.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
neepllrkssrrfvifpiqypdiwkmykqaqasfwtaeevdlskdlphwnklkadekyfi
shilaffaasdgivnenlverfsqevqvpearcfygfqilienvhsemysllidtyirdp
kkreflfnaimpyvkkkadwalrwiadrkstfgervvafaavegvffsgsfaaifwlkkr
glmpgltfsnelisrdeglhcdfaclmfqylvnkpseervreiivdavkieqefltealp
vgligmncilmkqyiefvadrllvelgfskvfqaenpfdfmenisl

SCOPe Domain Coordinates for d3hf1b_:

Click to download the PDB-style file with coordinates for d3hf1b_.
(The format of our PDB-style files is described here.)

Timeline for d3hf1b_: