Lineage for d3herb_ (3her B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175107Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2175108Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2175109Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2175173Protein automated matches [191016] (9 species)
    not a true protein
  7. 2175182Species Human (Homo sapiens) [TaxId:9606] [188783] (8 PDB entries)
  8. 2175185Domain d3herb_: 3her B: [246492]
    automated match to d1fo7a_
    complexed with cd

Details for d3herb_

PDB Entry: 3her (more details), 1.85 Å

PDB Description: human prion protein variant f198s with v129
PDB Compounds: (B:) major prion protein

SCOPe Domain Sequences for d3herb_:

Sequence, based on SEQRES records: (download)

>d3herb_ d.6.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvnitik
qhtvttttkgenstetdvkmmervveqmcitqyeresqayyq

Sequence, based on observed residues (ATOM records): (download)

>d3herb_ d.6.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvnitik
qhtvtstetdvkmmervveqmcitqyeresqayyq

SCOPe Domain Coordinates for d3herb_:

Click to download the PDB-style file with coordinates for d3herb_.
(The format of our PDB-style files is described here.)

Timeline for d3herb_: