Lineage for d1lepa_ (1lep A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13334Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 13335Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 13336Family b.35.1.1: GroES [50130] (2 proteins)
  6. 13337Protein Chaperonin-10 (GroES) [50131] (2 species)
  7. 13346Species Mycobacterium leprae [TaxId:1769] [50133] (1 PDB entry)
  8. 13347Domain d1lepa_: 1lep A: [24649]

Details for d1lepa_

PDB Entry: 1lep (more details), 3.5 Å

PDB Description: three-dimensional structure of the immunodominant heat-shock protein chaperonin-10 of mycobacterium leprae

SCOP Domain Sequences for d1lepa_:

Sequence, based on SEQRES records: (download)

>d1lepa_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium leprae}
akvkikpledkilvqageaetmtpsglvipenakekpqegtvvavgpgrwdedgakripv
dvsegdiviyskyggteikyngeeylilsardvlavvsk

Sequence, based on observed residues (ATOM records): (download)

>d1lepa_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium leprae}
akvkikpledkilvqaekpqegtvvavgpgrwdedgakripvdvsegdiviyskyggtei
kyngeeylilsardvlavvsk

SCOP Domain Coordinates for d1lepa_:

Click to download the PDB-style file with coordinates for d1lepa_.
(The format of our PDB-style files is described here.)

Timeline for d1lepa_: