![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.120.1: PIN domain-like [88723] (3 families) ![]() |
![]() | Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
![]() | Protein T4 RNase H [53046] (1 species) |
![]() | Species Bacteriophage T4 [TaxId:10665] [53047] (6 PDB entries) |
![]() | Domain d3h8wa1: 3h8w A:11-180 [246486] Other proteins in same PDB: d3h8wa2 automated match to d3h7ia1 |
PDB Entry: 3h8w (more details), 2.8 Å
SCOPe Domain Sequences for d3h8wa1:
Sequence, based on SEQRES records: (download)
>d3h8wa1 c.120.1.2 (A:11-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]} ykegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlci dnaksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaympyivmdidkye andhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki
>d3h8wa1 c.120.1.2 (A:11-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]} ykegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlci dnaksgywrrdfayyykktwdwegyfesshkvidelkaympyivmdidkyeandhiavlv kkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki
Timeline for d3h8wa1: