Lineage for d3h8wa1 (3h8w A:11-180)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885042Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 1885043Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 1885099Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 1885123Protein T4 RNase H [53046] (1 species)
  7. 1885124Species Bacteriophage T4 [TaxId:10665] [53047] (6 PDB entries)
  8. 1885129Domain d3h8wa1: 3h8w A:11-180 [246486]
    Other proteins in same PDB: d3h8wa2
    automated match to d3h7ia1

Details for d3h8wa1

PDB Entry: 3h8w (more details), 2.8 Å

PDB Description: structure of d132n t4 rnase h in the presence of divalent magnesium
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d3h8wa1:

Sequence, based on SEQRES records: (download)

>d3h8wa1 c.120.1.2 (A:11-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
ykegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlci
dnaksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaympyivmdidkye
andhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki

Sequence, based on observed residues (ATOM records): (download)

>d3h8wa1 c.120.1.2 (A:11-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
ykegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlci
dnaksgywrrdfayyykktwdwegyfesshkvidelkaympyivmdidkyeandhiavlv
kkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki

SCOPe Domain Coordinates for d3h8wa1:

Click to download the PDB-style file with coordinates for d3h8wa1.
(The format of our PDB-style files is described here.)

Timeline for d3h8wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h8wa2