Class b: All beta proteins [48724] (126 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (2 families) |
Family b.35.1.1: GroES [50130] (2 proteins) |
Protein Chaperonin-10 (GroES) [50131] (3 species) |
Species Escherichia coli [TaxId:562] [50132] (1 PDB entry) |
Domain d1aonu_: 1aon U: [24648] Other proteins in same PDB: d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3 complexed with adp, mg |
PDB Entry: 1aon (more details), 3 Å
SCOP Domain Sequences for d1aonu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aonu_ b.35.1.1 (U:) Chaperonin-10 (GroES) {Escherichia coli} mnirplhdrvivkrkevetksaggivltgsaaakstrgevlavgngrilengevkpldvk vgdivifndgygvksekidneevlimsesdilaivea
Timeline for d1aonu_:
View in 3D Domains from other chains: (mouse over for more information) d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_ |