![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [227637] (5 PDB entries) |
![]() | Domain d3h76b2: 3h76 B:177-329 [246477] |
PDB Entry: 3h76 (more details), 1.8 Å
SCOPe Domain Sequences for d3h76b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h76b2 c.95.1.0 (B:177-329) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} glldlrlgadgnyfdllmtaapgsasptfldenvlregggeflmrgrpmfehasqtlvri agemlaaheltlddidhvichqpnlrildavqeqlgipqhkfavtvdrlgnmasastpvt lamfwpdiqpgqrvlvltygsgatwgaalyrkp
Timeline for d3h76b2: