SCOPe 2.05: Domain d3h65a2: 3h65 A:243-345

Lineage for d3h65a2 (3h65 A:243-345)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.11: HMD dimerization domain-like [140777] (1 protein)
   dimer similar to those of the GDP-mannose 6-dehydrogenase and class I KARI domains
   automatically mapped to Pfam PF03201

6. Protein 5,10-methenyltetrahydromethanopterin hydrogenase, HMD [140778] (1 species)

7. Species Methanocaldococcus jannaschii [TaxId:2190] [140779] (6 PDB entries)
   Uniprot Q58194 243-344

8. Domain d3h65a2: 3h65 A:243-345 [246473]
   Other proteins in same PDB: d3h65a1
   automated match to d3f47a2
   complexed with cmo, dtv, fe2, h4m, i2c

Details for d3h65a2

PDB Entry: 3h65, 2.15 Å

PDB Description: the crystal structure of c176a mutated [fe]-hydrogenase (hmd) holoenzyme in complex with methylenetetrahydromethanopterin

PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d3h65a2:

Sequence; same for both SEQRES and ATOM records:

>d3h65a2 a.100.1.11 (A:243-345) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Methanocaldococcus jannaschii [TaxId: 2190]}
anligpvcdmcsavtatvyagllayrdavtkilgapadfaqmmadealtqihnlmkekgi
anmeealdpaallgtadsmcfgplaeilptalkvlekhkvvee

Timeline for d3h65a2:

• d3h65a2 first appeared in SCOPe 2.04
  
• d3h65a2 appears in SCOPe 2.06
  
• d3h65a2 appears in the current release, SCOPe 2.08