SCOPe 2.06: Domain d3h65a1: 3h65 A:1-242

Lineage for d3h65a1 (3h65 A:1-242)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein 5,10-methenyltetrahydromethanopterin hydrogenase, HMD [141932] (1 species)

7. Species Methanocaldococcus jannaschii [TaxId:2190] [141933] (6 PDB entries)
   Uniprot Q58194 1-242

8. Domain d3h65a1: 3h65 A:1-242 [246472]
   Other proteins in same PDB: d3h65a2
   automated match to d3f47a1
   complexed with cmo, dtv, fe2, h4m, i2c

Details for d3h65a1

PDB Entry: 3h65, 2.15 Å

PDB Description: the crystal structure of c176a mutated [fe]-hydrogenase (hmd) holoenzyme in complex with methylenetetrahydromethanopterin

PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d3h65a1:

Sequence; same for both SEQRES and ATOM records:

>d3h65a1 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Methanocaldococcus jannaschii [TaxId: 2190]}
mkiailgagcyrthaaagitnfmracevakevgkpeialthssitygaellhlvpdvkev
ivsdpcfaeepglvvidefdpkevmeahlsgnpesimpkirevvkakakelpkppkacih
lvhpedvglkvtsddreavegadivitwlpkgnkqpdiikkfadaipegaivthaatipt
tkfakifkdlgredlnitsyhpgcvpemkgqvyiaegyaseeavnklyeigkiargkafk
mp

Timeline for d3h65a1:

• d3h65a1 first appeared in SCOPe 2.04
  
• d3h65a1 appears in SCOPe 2.05
  
• d3h65a1 appears in SCOPe 2.07
  
• d3h65a1 appears in the current release, SCOPe 2.08