SCOPe 2.06: Domain d3h5qa2: 3h5q A:71-330

Lineage for d3h5qa2 (3h5q A:71-330)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families)
   automatically mapped to Pfam PF00591

5. Family c.27.1.0: automated matches [254295] (1 protein)
   not a true family

6. Protein automated matches [254679] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [255859] (1 PDB entry)

8. Domain d3h5qa2: 3h5q A:71-330 [246470]
   Other proteins in same PDB: d3h5qa1, d3h5qa3, d3h5qa4
   automated match to d1brwa2
   complexed with so4, thm

Details for d3h5qa2

PDB Entry: 3h5q, 1.94 Å

PDB Description: crystal structure of a putative pyrimidine-nucleoside phosphorylase from staphylococcus aureus

PDB Compounds: (A:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d3h5qa2:

Sequence; same for both SEQRES and ATOM records:

>d3h5qa2 c.27.1.0 (A:71-330) automated matches {Staphylococcus aureus [TaxId: 93062]}
lsdikgvkvdkhstggvgdtttlvlaplvaavdvpvakmsgrglghtggtidkleaidgf
hveideatfvklvnenkvavvgqsgnltpadkklyalrdvtgtvnsipliassimskkia
agadaivldvktgsgafmktledaealahamvrignnvgrntmaiisdmnqplgraigna
lelqeaidtlkgqgpkdltelvltlgsqmvvlankaetleearallieainsgaalekfk
tfiknqggdetvidhperlp

Timeline for d3h5qa2:

• d3h5qa2 first appeared in SCOPe 2.04
  
• d3h5qa2 appears in SCOPe 2.05
  
• d3h5qa2 appears in SCOPe 2.07
  
• d3h5qa2 appears in the current release, SCOPe 2.08