SCOPe 2.06: Domain d3h5qa1: 3h5q A:1-70

Lineage for d3h5qa1 (3h5q A:1-70)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.0: automated matches [254276] (1 protein)
   not a true family

6. Protein automated matches [254641] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [255858] (1 PDB entry)

8. Domain d3h5qa1: 3h5q A:1-70 [246469]
   Other proteins in same PDB: d3h5qa2, d3h5qa3, d3h5qa4
   automated match to d1brwa1
   complexed with so4, thm

Details for d3h5qa1

PDB Entry: 3h5q, 1.94 Å

PDB Description: crystal structure of a putative pyrimidine-nucleoside phosphorylase from staphylococcus aureus

PDB Compounds: (A:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d3h5qa1:

Sequence; same for both SEQRES and ATOM records:

>d3h5qa1 a.46.2.0 (A:1-70) automated matches {Staphylococcus aureus [TaxId: 93062]}
mrmidiiekkrdghtltteeinffiggyvkgdipdyqasslamaiyfqdmnddervaltm
amvnsgdmid

Timeline for d3h5qa1:

• d3h5qa1 first appeared in SCOPe 2.04
  
• d3h5qa1 appears in SCOPe 2.05
  
• d3h5qa1 appears in SCOPe 2.07
  
• d3h5qa1 appears in the current release, SCOPe 2.08