SCOPe 2.08: Domain d3h4mc_: 3h4m C:

Lineage for d3h4mc_ (3h4m C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Proteasome-activating nucleotidase PAN, C-terminal domain [346084] (1 species)

7. Species Methanocaldococcus jannaschii [TaxId:2190] [346303] (1 PDB entry)

8. Domain d3h4mc_: 3h4m C: [246466]
   automated match to d1iy2a_
   complexed with adp

Details for d3h4mc_

PDB Entry: 3h4m, 3.11 Å

PDB Description: AAA ATPase domain of the proteasome- activating nucleotidase

PDB Compounds: (C:) Proteasome-activating nucleotidase

SCOPe Domain Sequences for d3h4mc_:

Sequence; same for both SEQRES and ATOM records:

>d3h4mc_ c.37.1.20 (C:) Proteasome-activating nucleotidase PAN, C-terminal domain {Methanocaldococcus jannaschii [TaxId: 2190]}
amevderpnvryedigglekqmqeirevvelplkhpelfekvgieppkgillygppgtgk
tllakavatetnatfirvvgselvkkfigegaslvkdifklakekapsiifideidaiaa
krtdaltggdrevqrtlmqllaemdgfdargdvkiigatnrpdildpailrpgrfdriie
vpapdekgrleilkihtrkmnlaedvnleeiakmtegcvgaelkaicteagmnairelrd
yvtmddfrkavekimekkkvk

Timeline for d3h4mc_:

• d3h4mc_ first appeared in SCOPe 2.04
  
• d3h4mc_ appears in SCOPe 2.07