SCOPe 2.07: Domain d3h1js_: 3h1j S:

Lineage for d3h1js_ (3h1j S:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex
   automatically mapped to Pfam PF02271

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein automated matches [190325] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189228] (8 PDB entries)

8. Domain d3h1js_: 3h1j S: [246458]
   Other proteins in same PDB: d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1jt_, d3h1ju_, d3h1jw_
   automated match to d1l0lf_
   complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq

Details for d3h1js_

PDB Entry: 3h1j, 3 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

PDB Compounds: (S:) Mitochondrial ubiquinol-cytochrome c reductase 14 kda protein

SCOPe Domain Sequences for d3h1js_:

Sequence; same for both SEQRES and ATOM records:

>d3h1js_ f.27.1.1 (S:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk

Timeline for d3h1js_:

• d3h1js_ first appeared in SCOPe 2.04
  
• d3h1js_ appears in SCOPe 2.06
  
• d3h1js_ appears in the current release, SCOPe 2.08