| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) ![]() location - matrix side of the bc1 complex automatically mapped to Pfam PF02271 |
| Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
| Protein automated matches [190325] (4 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [189228] (8 PDB entries) |
| Domain d3h1js_: 3h1j S: [246458] Other proteins in same PDB: d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1jt_, d3h1ju_, d3h1jw_ automated match to d1l0lf_ complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq |
PDB Entry: 3h1j (more details), 3 Å
SCOPe Domain Sequences for d3h1js_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1js_ f.27.1.1 (S:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk
Timeline for d3h1js_:
View in 3DDomains from other chains: (mouse over for more information) d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1jt_, d3h1ju_, d3h1jw_ |