Lineage for d3h1js_ (3h1j S:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027685Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 3027686Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 3027687Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 3027717Protein automated matches [190325] (4 species)
    not a true protein
  7. 3027730Species Chicken (Gallus gallus) [TaxId:9031] [189228] (8 PDB entries)
  8. 3027746Domain d3h1js_: 3h1j S: [246458]
    Other proteins in same PDB: d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1jt_, d3h1ju_, d3h1jw_
    automated match to d1l0lf_
    complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq

Details for d3h1js_

PDB Entry: 3h1j (more details), 3 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken
PDB Compounds: (S:) Mitochondrial ubiquinol-cytochrome c reductase 14 kda protein

SCOPe Domain Sequences for d3h1js_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1js_ f.27.1.1 (S:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk

SCOPe Domain Coordinates for d3h1js_:

Click to download the PDB-style file with coordinates for d3h1js_.
(The format of our PDB-style files is described here.)

Timeline for d3h1js_: