Lineage for d3h1jn1 (3h1j N:3-233)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684578Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1684579Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1684848Family d.185.1.0: automated matches [232765] (1 protein)
    not a true family
  6. 1684849Protein automated matches [232766] (2 species)
    not a true protein
  7. 1684850Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries)
  8. 1684886Domain d3h1jn1: 3h1j N:3-233 [246450]
    Other proteins in same PDB: d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1js_, d3h1jt_, d3h1ju_, d3h1jw_
    automated match to d3l71a1
    complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq

Details for d3h1jn1

PDB Entry: 3h1j (more details), 3 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken
PDB Compounds: (N:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i

SCOPe Domain Sequences for d3h1jn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1jn1 d.185.1.0 (N:3-233) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tyaqtlqnipetnvttldnglrvaseessqptctvgvwigagsryeneknngagyfvehl
afkgtkkrpcaafekevesmgahfngytsreqtafyikalskdmpkvvelladvvqncal
eesqiekergvilqelkemdndmtnvtfdylhatafqgtalartvegttenikhltradl
asyidthfkaprmvlaaaggishkelvdaarqhfsgvsftykedavpilpr

SCOPe Domain Coordinates for d3h1jn1:

Click to download the PDB-style file with coordinates for d3h1jn1.
(The format of our PDB-style files is described here.)

Timeline for d3h1jn1: