Lineage for d3h1jh_ (3h1j H:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027753Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 3027754Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 3027755Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 3027789Protein automated matches [190042] (4 species)
    not a true protein
  7. 3027792Species Chicken (Gallus gallus) [TaxId:9031] [189230] (8 PDB entries)
  8. 3027807Domain d3h1jh_: 3h1j H: [246448]
    Other proteins in same PDB: d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jf_, d3h1jg_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1js_, d3h1jt_, d3h1jw_
    automated match to d3l75h_
    complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq

Details for d3h1jh_

PDB Entry: 3h1j (more details), 3 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken
PDB Compounds: (H:) Mitochondrial ubiquinol-cytochrome c reductase 11 kda protein, complex iii subunit viii

SCOPe Domain Sequences for d3h1jh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1jh_ f.28.1.1 (H:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
eeeelvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhc
vahklfnklk

SCOPe Domain Coordinates for d3h1jh_:

Click to download the PDB-style file with coordinates for d3h1jh_.
(The format of our PDB-style files is described here.)

Timeline for d3h1jh_: