![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) ![]() automatically mapped to Pfam PF02939 |
![]() | Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins) |
![]() | Protein automated matches [191133] (1 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries) |
![]() | Domain d3h1jg_: 3h1j G: [246447] Other proteins in same PDB: d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1jf_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1js_, d3h1ju_, d3h1jw_ automated match to d3l75g_ complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq |
PDB Entry: 3h1j (more details), 3 Å
SCOPe Domain Sequences for d3h1jg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1jg_ f.23.13.1 (G:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} gihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllys wgtqeferlkrknpadyendq
Timeline for d3h1jg_: