Lineage for d3h1jd2 (3h1j D:196-241)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631158Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) (S)
  5. 2631203Family f.23.11.0: automated matches [232790] (1 protein)
    not a true family
  6. 2631204Protein automated matches [232791] (3 species)
    not a true protein
  7. 2631209Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries)
  8. 2631218Domain d3h1jd2: 3h1j D:196-241 [246445]
    Other proteins in same PDB: d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1je1, d3h1je2, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jr1, d3h1jr2, d3h1js_, d3h1jt_, d3h1ju_, d3h1jw_
    automated match to d3l70d2
    complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq

Details for d3h1jd2

PDB Entry: 3h1j (more details), 3 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken
PDB Compounds: (D:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3h1jd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1jd2 f.23.11.0 (D:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk

SCOPe Domain Coordinates for d3h1jd2:

Click to download the PDB-style file with coordinates for d3h1jd2.
(The format of our PDB-style files is described here.)

Timeline for d3h1jd2: