SCOPe 2.07: Domain d3h1jd1: 3h1j D:1-195

Lineage for d3h1jd1 (3h1j D:1-195)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein automated matches [232767] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries)

8. Domain d3h1jd1: 3h1j D:1-195 [246444]
   Other proteins in same PDB: d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd2, d3h1je1, d3h1je2, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq2, d3h1jr1, d3h1jr2, d3h1js_, d3h1jt_, d3h1ju_, d3h1jw_
   automated match to d3l71d1
   complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq

Details for d3h1jd1

PDB Entry: 3h1j, 3 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

PDB Compounds: (D:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3h1jd1:

Sequence; same for both SEQRES and ATOM records:

>d3h1jd1 a.3.1.3 (D:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae
akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar
hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms
qiakdvctflrwaae

Timeline for d3h1jd1:

• d3h1jd1 first appeared in SCOPe 2.04
  
• d3h1jd1 appears in SCOPe 2.06
  
• d3h1jd1 appears in the current release, SCOPe 2.08