Lineage for d3h1jc2 (3h1j C:262-380)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027980Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 3027981Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 3028050Family f.32.1.0: automated matches [254197] (1 protein)
    not a true family
  6. 3028051Protein automated matches [254431] (4 species)
    not a true protein
  7. 3028057Species Chicken (Gallus gallus) [TaxId:9031] [255857] (4 PDB entries)
  8. 3028064Domain d3h1jc2: 3h1j C:262-380 [246443]
    Other proteins in same PDB: d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1js_, d3h1jt_, d3h1ju_, d3h1jw_
    automated match to d3l75c2
    complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq

Details for d3h1jc2

PDB Entry: 3h1j (more details), 3 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3h1jc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1jc2 f.32.1.0 (C:262-380) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

SCOPe Domain Coordinates for d3h1jc2:

Click to download the PDB-style file with coordinates for d3h1jc2.
(The format of our PDB-style files is described here.)

Timeline for d3h1jc2: