![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.0: automated matches [232765] (1 protein) not a true family |
![]() | Protein automated matches [232766] (2 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries) |
![]() | Domain d3h1ja1: 3h1j A:2-233 [246438] Other proteins in same PDB: d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1js_, d3h1jt_, d3h1ju_, d3h1jw_ automated match to d3l71a1 complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq |
PDB Entry: 3h1j (more details), 3 Å
SCOPe Domain Sequences for d3h1ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1ja1 d.185.1.0 (A:2-233) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} atyaqtlqnipetnvttldnglrvaseessqptctvgvwigagsryeneknngagyfveh lafkgtkkrpcaafekevesmgahfngytsreqtafyikalskdmpkvvelladvvqnca leesqiekergvilqelkemdndmtnvtfdylhatafqgtalartvegttenikhltrad lasyidthfkaprmvlaaaggishkelvdaarqhfsgvsftykedavpilpr
Timeline for d3h1ja1:
![]() Domains from other chains: (mouse over for more information) d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1je1, d3h1je2, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1js_, d3h1jt_, d3h1ju_, d3h1jw_ |