SCOPe 2.04: Domain d3h1ht_: 3h1h T:

Lineage for d3h1ht_ (3h1h T:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)
   automatically mapped to Pfam PF02939

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein automated matches [191133] (1 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries)

8. Domain d3h1ht_: 3h1h T: [246435]
   Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1hf_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hs_, d3h1hu_, d3h1hw_
   automated match to d3l75g_
   complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1ht_

PDB Entry: 3h1h, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

PDB Compounds: (T:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d3h1ht_:

Sequence; same for both SEQRES and ATOM records:

>d3h1ht_ f.23.13.1 (T:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw
gtqeferlkrknpadyend

Timeline for d3h1ht_:

• d3h1ht_ is new in SCOPe 2.04-stable
  
• d3h1ht_ appears in SCOPe 2.05
  
• d3h1ht_ appears in the current release, SCOPe 2.07